[chore]: Bump github.com/minio/minio-go/v7 from 7.0.65 to 7.0.66 (#2467)

Bumps [github.com/minio/minio-go/v7](https://github.com/minio/minio-go) from 7.0.65 to 7.0.66.
- [Release notes](https://github.com/minio/minio-go/releases)
- [Commits](https://github.com/minio/minio-go/compare/v7.0.65...v7.0.66)

---
updated-dependencies:
- dependency-name: github.com/minio/minio-go/v7
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: kim <89579420+NyaaaWhatsUpDoc@users.noreply.github.com>
This commit is contained in:
dependabot[bot] 2024-01-03 10:34:54 +00:00 committed by GitHub
parent 31481fad35
commit 0cb1dd493c
No known key found for this signature in database
GPG key ID: 4AEE18F83AFDEB23
13 changed files with 404 additions and 263 deletions

6
go.mod
View file

@ -37,7 +37,7 @@ require (
github.com/jackc/pgx/v5 v5.5.1 github.com/jackc/pgx/v5 v5.5.1
github.com/microcosm-cc/bluemonday v1.0.26 github.com/microcosm-cc/bluemonday v1.0.26
github.com/miekg/dns v1.1.57 github.com/miekg/dns v1.1.57
github.com/minio/minio-go/v7 v7.0.65 github.com/minio/minio-go/v7 v7.0.66
github.com/mitchellh/mapstructure v1.5.0 github.com/mitchellh/mapstructure v1.5.0
github.com/oklog/ulid v1.3.1 github.com/oklog/ulid v1.3.1
github.com/prometheus/client_golang v1.17.0 github.com/prometheus/client_golang v1.17.0
@ -132,8 +132,8 @@ require (
github.com/jinzhu/inflection v1.0.0 // indirect github.com/jinzhu/inflection v1.0.0 // indirect
github.com/json-iterator/go v1.1.12 // indirect github.com/json-iterator/go v1.1.12 // indirect
github.com/kballard/go-shellquote v0.0.0-20180428030007-95032a82bc51 // indirect github.com/kballard/go-shellquote v0.0.0-20180428030007-95032a82bc51 // indirect
github.com/klauspost/compress v1.17.2 // indirect github.com/klauspost/compress v1.17.4 // indirect
github.com/klauspost/cpuid/v2 v2.2.5 // indirect github.com/klauspost/cpuid/v2 v2.2.6 // indirect
github.com/leodido/go-urn v1.2.4 // indirect github.com/leodido/go-urn v1.2.4 // indirect
github.com/magiconair/properties v1.8.7 // indirect github.com/magiconair/properties v1.8.7 // indirect
github.com/mattn/go-isatty v0.0.19 // indirect github.com/mattn/go-isatty v0.0.19 // indirect

12
go.sum
View file

@ -365,12 +365,12 @@ github.com/kballard/go-shellquote v0.0.0-20180428030007-95032a82bc51/go.mod h1:C
github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck=
github.com/klauspost/compress v1.10.4/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs= github.com/klauspost/compress v1.10.4/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs=
github.com/klauspost/compress v1.10.10/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs= github.com/klauspost/compress v1.10.10/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs=
github.com/klauspost/compress v1.17.2 h1:RlWWUY/Dr4fL8qk9YG7DTZ7PDgME2V4csBXA8L/ixi4= github.com/klauspost/compress v1.17.4 h1:Ej5ixsIri7BrIjBkRZLTo6ghwrEtHFk7ijlczPW4fZ4=
github.com/klauspost/compress v1.17.2/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE= github.com/klauspost/compress v1.17.4/go.mod h1:/dCuZOvVtNoHsyb+cuJD3itjs3NbnF6KH9zAO4BDxPM=
github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg= github.com/klauspost/cpuid/v2 v2.2.6 h1:ndNyv040zDGIDh8thGkXYjnFtiN02M1PVVF+JE/48xc=
github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= github.com/klauspost/cpuid/v2 v2.2.6/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
github.com/knz/go-libedit v1.10.1/go.mod h1:MZTVkCWyz0oBc7JOWP3wNAzd002ZbM/5hgShxwh4x8M= github.com/knz/go-libedit v1.10.1/go.mod h1:MZTVkCWyz0oBc7JOWP3wNAzd002ZbM/5hgShxwh4x8M=
github.com/kr/fs v0.1.0/go.mod h1:FFnZGqtBN9Gxj7eW1uZ42v5BccTP0vu6NEaFoC2HwRg= github.com/kr/fs v0.1.0/go.mod h1:FFnZGqtBN9Gxj7eW1uZ42v5BccTP0vu6NEaFoC2HwRg=
github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
@ -403,8 +403,8 @@ github.com/miekg/dns v1.1.57 h1:Jzi7ApEIzwEPLHWRcafCN9LZSBbqQpxjt/wpgvg7wcM=
github.com/miekg/dns v1.1.57/go.mod h1:uqRjCRUuEAA6qsOiJvDd+CFo/vW+y5WR6SNmHE55hZk= github.com/miekg/dns v1.1.57/go.mod h1:uqRjCRUuEAA6qsOiJvDd+CFo/vW+y5WR6SNmHE55hZk=
github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34= github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM= github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
github.com/minio/minio-go/v7 v7.0.65 h1:sOlB8T3nQK+TApTpuN3k4WD5KasvZIE3vVFzyyCa0go= github.com/minio/minio-go/v7 v7.0.66 h1:bnTOXOHjOqv/gcMuiVbN9o2ngRItvqE774dG9nq0Dzw=
github.com/minio/minio-go/v7 v7.0.65/go.mod h1:R4WVUR6ZTedlCcGwZRauLMIKjgyaWxhs4Mqi/OMPmEc= github.com/minio/minio-go/v7 v7.0.66/go.mod h1:DHAgmyQEGdW3Cif0UooKOyrT3Vxs82zNdV6tkKhRtbs=
github.com/minio/sha256-simd v1.0.1 h1:6kaan5IFmwTNynnKKpDHe6FWHohJOHhCPchzK49dzMM= github.com/minio/sha256-simd v1.0.1 h1:6kaan5IFmwTNynnKKpDHe6FWHohJOHhCPchzK49dzMM=
github.com/minio/sha256-simd v1.0.1/go.mod h1:Pz6AKMiUdngCLpeTL/RJY1M9rUuPMYujV5xJjtbRSN8= github.com/minio/sha256-simd v1.0.1/go.mod h1:Pz6AKMiUdngCLpeTL/RJY1M9rUuPMYujV5xJjtbRSN8=
github.com/mitchellh/hashstructure/v2 v2.0.2 h1:vGKWl0YJqUNxE8d+h8f6NJLcCJrgbhC4NcD46KavDd4= github.com/mitchellh/hashstructure/v2 v2.0.2 h1:vGKWl0YJqUNxE8d+h8f6NJLcCJrgbhC4NcD46KavDd4=

View file

@ -238,6 +238,11 @@ func (z *Reader) readHeader() (hdr Header, err error) {
} }
} }
// Reserved FLG bits must be zero.
if flg>>5 != 0 {
return hdr, ErrHeader
}
z.digest = 0 z.digest = 0
if z.decompressor == nil { if z.decompressor == nil {
z.decompressor = flate.NewReader(z.r) z.decompressor = flate.NewReader(z.r)

View file

@ -9,10 +9,7 @@ You can access the CPU information by accessing the shared CPU variable of the c
Package home: https://github.com/klauspost/cpuid Package home: https://github.com/klauspost/cpuid
[![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2) [![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
[![Build Status][3]][4] [![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master
[4]: https://travis-ci.org/klauspost/cpuid
## installing ## installing
@ -285,7 +282,12 @@ Exit Code 1
| AMXINT8 | Tile computational operations on 8-bit integers | | AMXINT8 | Tile computational operations on 8-bit integers |
| AMXFP16 | Tile computational operations on FP16 numbers | | AMXFP16 | Tile computational operations on FP16 numbers |
| AMXTILE | Tile architecture | | AMXTILE | Tile architecture |
| APX_F | Intel APX |
| AVX | AVX functions | | AVX | AVX functions |
| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
| AVX10_128 | If set indicates that AVX10 128-bit vector support is present |
| AVX10_256 | If set indicates that AVX10 256-bit vector support is present |
| AVX10_512 | If set indicates that AVX10 512-bit vector support is present |
| AVX2 | AVX2 functions | | AVX2 | AVX2 functions |
| AVX512BF16 | AVX-512 BFLOAT16 Instructions | | AVX512BF16 | AVX-512 BFLOAT16 Instructions |
| AVX512BITALG | AVX-512 Bit Algorithms | | AVX512BITALG | AVX-512 Bit Algorithms |
@ -365,6 +367,8 @@ Exit Code 1
| IDPRED_CTRL | IPRED_DIS | | IDPRED_CTRL | IPRED_DIS |
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. | | INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
| INVLPGB | NVLPGB and TLBSYNC instruction supported | | INVLPGB | NVLPGB and TLBSYNC instruction supported |
| KEYLOCKER | Key locker |
| KEYLOCKERW | Key locker wide |
| LAHF | LAHF/SAHF in long mode | | LAHF | LAHF/SAHF in long mode |
| LAM | If set, CPU supports Linear Address Masking | | LAM | If set, CPU supports Linear Address Masking |
| LBRVIRT | LBR virtualization | | LBRVIRT | LBR virtualization |
@ -380,7 +384,7 @@ Exit Code 1
| MOVDIRI | Move Doubleword as Direct Store | | MOVDIRI | Move Doubleword as Direct Store |
| MOVSB_ZL | Fast Zero-Length MOVSB | | MOVSB_ZL | Fast Zero-Length MOVSB |
| MPX | Intel MPX (Memory Protection Extensions) | | MPX | Intel MPX (Memory Protection Extensions) |
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | | MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
| MSRIRC | Instruction Retired Counter MSR available | | MSRIRC | Instruction Retired Counter MSR available |
| MSRLIST | Read/Write List of Model Specific Registers | | MSRLIST | Read/Write List of Model Specific Registers |
| MSR_PAGEFLUSH | Page Flush MSR available | | MSR_PAGEFLUSH | Page Flush MSR available |

View file

@ -76,7 +76,12 @@
AMXFP16 // Tile computational operations on FP16 numbers AMXFP16 // Tile computational operations on FP16 numbers
AMXINT8 // Tile computational operations on 8-bit integers AMXINT8 // Tile computational operations on 8-bit integers
AMXTILE // Tile architecture AMXTILE // Tile architecture
APX_F // Intel APX
AVX // AVX functions AVX // AVX functions
AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
AVX10_128 // If set indicates that AVX10 128-bit vector support is present
AVX10_256 // If set indicates that AVX10 256-bit vector support is present
AVX10_512 // If set indicates that AVX10 512-bit vector support is present
AVX2 // AVX2 functions AVX2 // AVX2 functions
AVX512BF16 // AVX-512 BFLOAT16 Instructions AVX512BF16 // AVX-512 BFLOAT16 Instructions
AVX512BITALG // AVX-512 Bit Algorithms AVX512BITALG // AVX-512 Bit Algorithms
@ -156,6 +161,8 @@
IDPRED_CTRL // IPRED_DIS IDPRED_CTRL // IPRED_DIS
INT_WBINVD // WBINVD/WBNOINVD are interruptible. INT_WBINVD // WBINVD/WBNOINVD are interruptible.
INVLPGB // NVLPGB and TLBSYNC instruction supported INVLPGB // NVLPGB and TLBSYNC instruction supported
KEYLOCKER // Key locker
KEYLOCKERW // Key locker wide
LAHF // LAHF/SAHF in long mode LAHF // LAHF/SAHF in long mode
LAM // If set, CPU supports Linear Address Masking LAM // If set, CPU supports Linear Address Masking
LBRVIRT // LBR virtualization LBRVIRT // LBR virtualization
@ -302,9 +309,10 @@ type CPUInfo struct {
L2 int // L2 Cache (per core or shared). Will be -1 if undetected L2 int // L2 Cache (per core or shared). Will be -1 if undetected
L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected
} }
SGX SGXSupport SGX SGXSupport
maxFunc uint32 AVX10Level uint8
maxExFunc uint32 maxFunc uint32
maxExFunc uint32
} }
var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
@ -1165,6 +1173,7 @@ func support() flagSet {
fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
fs.setIf(ecx&(1<<13) != 0, TME) fs.setIf(ecx&(1<<13) != 0, TME)
fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
fs.setIf(ecx&(1<<23) != 0, KEYLOCKER)
fs.setIf(ecx&(1<<27) != 0, MOVDIRI) fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
fs.setIf(ecx&(1<<29) != 0, ENQCMD) fs.setIf(ecx&(1<<29) != 0, ENQCMD)
@ -1202,6 +1211,8 @@ func support() flagSet {
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
fs.setIf(edx1&(1<<14) != 0, PREFETCHI) fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
fs.setIf(edx1&(1<<19) != 0, AVX10)
fs.setIf(edx1&(1<<21) != 0, APX_F)
// Only detect AVX-512 features if XGETBV is supported // Only detect AVX-512 features if XGETBV is supported
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
@ -1252,6 +1263,19 @@ func support() flagSet {
fs.setIf(edx&(1<<4) != 0, BHI_CTRL) fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
fs.setIf(edx&(1<<5) != 0, MCDT_NO) fs.setIf(edx&(1<<5) != 0, MCDT_NO)
// Add keylocker features.
if fs.inSet(KEYLOCKER) && mfi >= 0x19 {
_, ebx, _, _ := cpuidex(0x19, 0)
fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4)
}
// Add AVX10 features.
if fs.inSet(AVX10) && mfi >= 0x24 {
_, ebx, _, _ := cpuidex(0x24, 0)
fs.setIf(ebx&(1<<16) != 0, AVX10_128)
fs.setIf(ebx&(1<<17) != 0, AVX10_256)
fs.setIf(ebx&(1<<18) != 0, AVX10_512)
}
} }
// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
@ -1394,6 +1418,20 @@ func support() flagSet {
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
} }
if mfi >= 0x20 {
// Microsoft has decided to purposefully hide the information
// of the guest TEE when VMs are being created using Hyper-V.
//
// This leads us to check for the Hyper-V cpuid features
// (0x4000000C), and then for the `ebx` value set.
//
// For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part
// we're mostly interested about,according to:
// https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174
_, ebx, _, _ := cpuid(0x4000000C)
fs.setIf(ebx == 0xbe3, TDX_GUEST)
}
if mfi >= 0x21 { if mfi >= 0x21 {
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
_, ebx, ecx, edx := cpuid(0x21) _, ebx, ecx, edx := cpuid(0x21)
@ -1404,6 +1442,14 @@ func support() flagSet {
return fs return fs
} }
func (c *CPUInfo) supportAVX10() uint8 {
if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) {
_, ebx, _, _ := cpuidex(0x24, 0)
return uint8(ebx)
}
return 0
}
func valAsString(values ...uint32) []byte { func valAsString(values ...uint32) []byte {
r := make([]byte, 4*len(values)) r := make([]byte, 4*len(values))
for i, v := range values { for i, v := range values {

View file

@ -31,6 +31,7 @@ func addInfo(c *CPUInfo, safe bool) {
c.LogicalCores = logicalCores() c.LogicalCores = logicalCores()
c.PhysicalCores = physicalCores() c.PhysicalCores = physicalCores()
c.VendorID, c.VendorString = vendorID() c.VendorID, c.VendorString = vendorID()
c.AVX10Level = c.supportAVX10()
c.cacheSize() c.cacheSize()
c.frequencies() c.frequencies()
} }

View file

@ -16,210 +16,217 @@ func _() {
_ = x[AMXFP16-6] _ = x[AMXFP16-6]
_ = x[AMXINT8-7] _ = x[AMXINT8-7]
_ = x[AMXTILE-8] _ = x[AMXTILE-8]
_ = x[AVX-9] _ = x[APX_F-9]
_ = x[AVX2-10] _ = x[AVX-10]
_ = x[AVX512BF16-11] _ = x[AVX10-11]
_ = x[AVX512BITALG-12] _ = x[AVX10_128-12]
_ = x[AVX512BW-13] _ = x[AVX10_256-13]
_ = x[AVX512CD-14] _ = x[AVX10_512-14]
_ = x[AVX512DQ-15] _ = x[AVX2-15]
_ = x[AVX512ER-16] _ = x[AVX512BF16-16]
_ = x[AVX512F-17] _ = x[AVX512BITALG-17]
_ = x[AVX512FP16-18] _ = x[AVX512BW-18]
_ = x[AVX512IFMA-19] _ = x[AVX512CD-19]
_ = x[AVX512PF-20] _ = x[AVX512DQ-20]
_ = x[AVX512VBMI-21] _ = x[AVX512ER-21]
_ = x[AVX512VBMI2-22] _ = x[AVX512F-22]
_ = x[AVX512VL-23] _ = x[AVX512FP16-23]
_ = x[AVX512VNNI-24] _ = x[AVX512IFMA-24]
_ = x[AVX512VP2INTERSECT-25] _ = x[AVX512PF-25]
_ = x[AVX512VPOPCNTDQ-26] _ = x[AVX512VBMI-26]
_ = x[AVXIFMA-27] _ = x[AVX512VBMI2-27]
_ = x[AVXNECONVERT-28] _ = x[AVX512VL-28]
_ = x[AVXSLOW-29] _ = x[AVX512VNNI-29]
_ = x[AVXVNNI-30] _ = x[AVX512VP2INTERSECT-30]
_ = x[AVXVNNIINT8-31] _ = x[AVX512VPOPCNTDQ-31]
_ = x[BHI_CTRL-32] _ = x[AVXIFMA-32]
_ = x[BMI1-33] _ = x[AVXNECONVERT-33]
_ = x[BMI2-34] _ = x[AVXSLOW-34]
_ = x[CETIBT-35] _ = x[AVXVNNI-35]
_ = x[CETSS-36] _ = x[AVXVNNIINT8-36]
_ = x[CLDEMOTE-37] _ = x[BHI_CTRL-37]
_ = x[CLMUL-38] _ = x[BMI1-38]
_ = x[CLZERO-39] _ = x[BMI2-39]
_ = x[CMOV-40] _ = x[CETIBT-40]
_ = x[CMPCCXADD-41] _ = x[CETSS-41]
_ = x[CMPSB_SCADBS_SHORT-42] _ = x[CLDEMOTE-42]
_ = x[CMPXCHG8-43] _ = x[CLMUL-43]
_ = x[CPBOOST-44] _ = x[CLZERO-44]
_ = x[CPPC-45] _ = x[CMOV-45]
_ = x[CX16-46] _ = x[CMPCCXADD-46]
_ = x[EFER_LMSLE_UNS-47] _ = x[CMPSB_SCADBS_SHORT-47]
_ = x[ENQCMD-48] _ = x[CMPXCHG8-48]
_ = x[ERMS-49] _ = x[CPBOOST-49]
_ = x[F16C-50] _ = x[CPPC-50]
_ = x[FLUSH_L1D-51] _ = x[CX16-51]
_ = x[FMA3-52] _ = x[EFER_LMSLE_UNS-52]
_ = x[FMA4-53] _ = x[ENQCMD-53]
_ = x[FP128-54] _ = x[ERMS-54]
_ = x[FP256-55] _ = x[F16C-55]
_ = x[FSRM-56] _ = x[FLUSH_L1D-56]
_ = x[FXSR-57] _ = x[FMA3-57]
_ = x[FXSROPT-58] _ = x[FMA4-58]
_ = x[GFNI-59] _ = x[FP128-59]
_ = x[HLE-60] _ = x[FP256-60]
_ = x[HRESET-61] _ = x[FSRM-61]
_ = x[HTT-62] _ = x[FXSR-62]
_ = x[HWA-63] _ = x[FXSROPT-63]
_ = x[HYBRID_CPU-64] _ = x[GFNI-64]
_ = x[HYPERVISOR-65] _ = x[HLE-65]
_ = x[IA32_ARCH_CAP-66] _ = x[HRESET-66]
_ = x[IA32_CORE_CAP-67] _ = x[HTT-67]
_ = x[IBPB-68] _ = x[HWA-68]
_ = x[IBRS-69] _ = x[HYBRID_CPU-69]
_ = x[IBRS_PREFERRED-70] _ = x[HYPERVISOR-70]
_ = x[IBRS_PROVIDES_SMP-71] _ = x[IA32_ARCH_CAP-71]
_ = x[IBS-72] _ = x[IA32_CORE_CAP-72]
_ = x[IBSBRNTRGT-73] _ = x[IBPB-73]
_ = x[IBSFETCHSAM-74] _ = x[IBRS-74]
_ = x[IBSFFV-75] _ = x[IBRS_PREFERRED-75]
_ = x[IBSOPCNT-76] _ = x[IBRS_PROVIDES_SMP-76]
_ = x[IBSOPCNTEXT-77] _ = x[IBS-77]
_ = x[IBSOPSAM-78] _ = x[IBSBRNTRGT-78]
_ = x[IBSRDWROPCNT-79] _ = x[IBSFETCHSAM-79]
_ = x[IBSRIPINVALIDCHK-80] _ = x[IBSFFV-80]
_ = x[IBS_FETCH_CTLX-81] _ = x[IBSOPCNT-81]
_ = x[IBS_OPDATA4-82] _ = x[IBSOPCNTEXT-82]
_ = x[IBS_OPFUSE-83] _ = x[IBSOPSAM-83]
_ = x[IBS_PREVENTHOST-84] _ = x[IBSRDWROPCNT-84]
_ = x[IBS_ZEN4-85] _ = x[IBSRIPINVALIDCHK-85]
_ = x[IDPRED_CTRL-86] _ = x[IBS_FETCH_CTLX-86]
_ = x[INT_WBINVD-87] _ = x[IBS_OPDATA4-87]
_ = x[INVLPGB-88] _ = x[IBS_OPFUSE-88]
_ = x[LAHF-89] _ = x[IBS_PREVENTHOST-89]
_ = x[LAM-90] _ = x[IBS_ZEN4-90]
_ = x[LBRVIRT-91] _ = x[IDPRED_CTRL-91]
_ = x[LZCNT-92] _ = x[INT_WBINVD-92]
_ = x[MCAOVERFLOW-93] _ = x[INVLPGB-93]
_ = x[MCDT_NO-94] _ = x[KEYLOCKER-94]
_ = x[MCOMMIT-95] _ = x[KEYLOCKERW-95]
_ = x[MD_CLEAR-96] _ = x[LAHF-96]
_ = x[MMX-97] _ = x[LAM-97]
_ = x[MMXEXT-98] _ = x[LBRVIRT-98]
_ = x[MOVBE-99] _ = x[LZCNT-99]
_ = x[MOVDIR64B-100] _ = x[MCAOVERFLOW-100]
_ = x[MOVDIRI-101] _ = x[MCDT_NO-101]
_ = x[MOVSB_ZL-102] _ = x[MCOMMIT-102]
_ = x[MOVU-103] _ = x[MD_CLEAR-103]
_ = x[MPX-104] _ = x[MMX-104]
_ = x[MSRIRC-105] _ = x[MMXEXT-105]
_ = x[MSRLIST-106] _ = x[MOVBE-106]
_ = x[MSR_PAGEFLUSH-107] _ = x[MOVDIR64B-107]
_ = x[NRIPS-108] _ = x[MOVDIRI-108]
_ = x[NX-109] _ = x[MOVSB_ZL-109]
_ = x[OSXSAVE-110] _ = x[MOVU-110]
_ = x[PCONFIG-111] _ = x[MPX-111]
_ = x[POPCNT-112] _ = x[MSRIRC-112]
_ = x[PPIN-113] _ = x[MSRLIST-113]
_ = x[PREFETCHI-114] _ = x[MSR_PAGEFLUSH-114]
_ = x[PSFD-115] _ = x[NRIPS-115]
_ = x[RDPRU-116] _ = x[NX-116]
_ = x[RDRAND-117] _ = x[OSXSAVE-117]
_ = x[RDSEED-118] _ = x[PCONFIG-118]
_ = x[RDTSCP-119] _ = x[POPCNT-119]
_ = x[RRSBA_CTRL-120] _ = x[PPIN-120]
_ = x[RTM-121] _ = x[PREFETCHI-121]
_ = x[RTM_ALWAYS_ABORT-122] _ = x[PSFD-122]
_ = x[SERIALIZE-123] _ = x[RDPRU-123]
_ = x[SEV-124] _ = x[RDRAND-124]
_ = x[SEV_64BIT-125] _ = x[RDSEED-125]
_ = x[SEV_ALTERNATIVE-126] _ = x[RDTSCP-126]
_ = x[SEV_DEBUGSWAP-127] _ = x[RRSBA_CTRL-127]
_ = x[SEV_ES-128] _ = x[RTM-128]
_ = x[SEV_RESTRICTED-129] _ = x[RTM_ALWAYS_ABORT-129]
_ = x[SEV_SNP-130] _ = x[SERIALIZE-130]
_ = x[SGX-131] _ = x[SEV-131]
_ = x[SGXLC-132] _ = x[SEV_64BIT-132]
_ = x[SHA-133] _ = x[SEV_ALTERNATIVE-133]
_ = x[SME-134] _ = x[SEV_DEBUGSWAP-134]
_ = x[SME_COHERENT-135] _ = x[SEV_ES-135]
_ = x[SPEC_CTRL_SSBD-136] _ = x[SEV_RESTRICTED-136]
_ = x[SRBDS_CTRL-137] _ = x[SEV_SNP-137]
_ = x[SSE-138] _ = x[SGX-138]
_ = x[SSE2-139] _ = x[SGXLC-139]
_ = x[SSE3-140] _ = x[SHA-140]
_ = x[SSE4-141] _ = x[SME-141]
_ = x[SSE42-142] _ = x[SME_COHERENT-142]
_ = x[SSE4A-143] _ = x[SPEC_CTRL_SSBD-143]
_ = x[SSSE3-144] _ = x[SRBDS_CTRL-144]
_ = x[STIBP-145] _ = x[SSE-145]
_ = x[STIBP_ALWAYSON-146] _ = x[SSE2-146]
_ = x[STOSB_SHORT-147] _ = x[SSE3-147]
_ = x[SUCCOR-148] _ = x[SSE4-148]
_ = x[SVM-149] _ = x[SSE42-149]
_ = x[SVMDA-150] _ = x[SSE4A-150]
_ = x[SVMFBASID-151] _ = x[SSSE3-151]
_ = x[SVML-152] _ = x[STIBP-152]
_ = x[SVMNP-153] _ = x[STIBP_ALWAYSON-153]
_ = x[SVMPF-154] _ = x[STOSB_SHORT-154]
_ = x[SVMPFT-155] _ = x[SUCCOR-155]
_ = x[SYSCALL-156] _ = x[SVM-156]
_ = x[SYSEE-157] _ = x[SVMDA-157]
_ = x[TBM-158] _ = x[SVMFBASID-158]
_ = x[TDX_GUEST-159] _ = x[SVML-159]
_ = x[TLB_FLUSH_NESTED-160] _ = x[SVMNP-160]
_ = x[TME-161] _ = x[SVMPF-161]
_ = x[TOPEXT-162] _ = x[SVMPFT-162]
_ = x[TSCRATEMSR-163] _ = x[SYSCALL-163]
_ = x[TSXLDTRK-164] _ = x[SYSEE-164]
_ = x[VAES-165] _ = x[TBM-165]
_ = x[VMCBCLEAN-166] _ = x[TDX_GUEST-166]
_ = x[VMPL-167] _ = x[TLB_FLUSH_NESTED-167]
_ = x[VMSA_REGPROT-168] _ = x[TME-168]
_ = x[VMX-169] _ = x[TOPEXT-169]
_ = x[VPCLMULQDQ-170] _ = x[TSCRATEMSR-170]
_ = x[VTE-171] _ = x[TSXLDTRK-171]
_ = x[WAITPKG-172] _ = x[VAES-172]
_ = x[WBNOINVD-173] _ = x[VMCBCLEAN-173]
_ = x[WRMSRNS-174] _ = x[VMPL-174]
_ = x[X87-175] _ = x[VMSA_REGPROT-175]
_ = x[XGETBV1-176] _ = x[VMX-176]
_ = x[XOP-177] _ = x[VPCLMULQDQ-177]
_ = x[XSAVE-178] _ = x[VTE-178]
_ = x[XSAVEC-179] _ = x[WAITPKG-179]
_ = x[XSAVEOPT-180] _ = x[WBNOINVD-180]
_ = x[XSAVES-181] _ = x[WRMSRNS-181]
_ = x[AESARM-182] _ = x[X87-182]
_ = x[ARMCPUID-183] _ = x[XGETBV1-183]
_ = x[ASIMD-184] _ = x[XOP-184]
_ = x[ASIMDDP-185] _ = x[XSAVE-185]
_ = x[ASIMDHP-186] _ = x[XSAVEC-186]
_ = x[ASIMDRDM-187] _ = x[XSAVEOPT-187]
_ = x[ATOMICS-188] _ = x[XSAVES-188]
_ = x[CRC32-189] _ = x[AESARM-189]
_ = x[DCPOP-190] _ = x[ARMCPUID-190]
_ = x[EVTSTRM-191] _ = x[ASIMD-191]
_ = x[FCMA-192] _ = x[ASIMDDP-192]
_ = x[FP-193] _ = x[ASIMDHP-193]
_ = x[FPHP-194] _ = x[ASIMDRDM-194]
_ = x[GPA-195] _ = x[ATOMICS-195]
_ = x[JSCVT-196] _ = x[CRC32-196]
_ = x[LRCPC-197] _ = x[DCPOP-197]
_ = x[PMULL-198] _ = x[EVTSTRM-198]
_ = x[SHA1-199] _ = x[FCMA-199]
_ = x[SHA2-200] _ = x[FP-200]
_ = x[SHA3-201] _ = x[FPHP-201]
_ = x[SHA512-202] _ = x[GPA-202]
_ = x[SM3-203] _ = x[JSCVT-203]
_ = x[SM4-204] _ = x[LRCPC-204]
_ = x[SVE-205] _ = x[PMULL-205]
_ = x[lastID-206] _ = x[SHA1-206]
_ = x[SHA2-207]
_ = x[SHA3-208]
_ = x[SHA512-209]
_ = x[SM3-210]
_ = x[SM4-211]
_ = x[SVE-212]
_ = x[lastID-213]
_ = x[firstID-0] _ = x[firstID-0]
} }
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465} var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 554, 568, 585, 588, 598, 609, 615, 623, 634, 642, 654, 670, 684, 695, 705, 720, 728, 739, 749, 756, 765, 775, 779, 782, 789, 794, 805, 812, 819, 827, 830, 836, 841, 850, 857, 865, 869, 872, 878, 885, 898, 903, 905, 912, 919, 925, 929, 938, 942, 947, 953, 959, 965, 975, 978, 994, 1003, 1006, 1015, 1030, 1043, 1049, 1063, 1070, 1073, 1078, 1081, 1084, 1096, 1110, 1120, 1123, 1127, 1131, 1135, 1140, 1145, 1150, 1155, 1169, 1180, 1186, 1189, 1194, 1203, 1207, 1212, 1217, 1223, 1230, 1235, 1238, 1247, 1263, 1266, 1272, 1282, 1290, 1294, 1303, 1307, 1319, 1322, 1332, 1335, 1342, 1350, 1357, 1360, 1367, 1370, 1375, 1381, 1389, 1395, 1401, 1409, 1414, 1421, 1428, 1436, 1443, 1448, 1453, 1460, 1464, 1466, 1470, 1473, 1478, 1483, 1488, 1492, 1496, 1500, 1506, 1509, 1512, 1515, 1521}
func (i FeatureID) String() string { func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {

View file

@ -87,10 +87,10 @@ func (o *GetObjectOptions) Set(key, value string) {
} }
// SetReqParam - set request query string parameter // SetReqParam - set request query string parameter
// supported key: see supportedQueryValues. // supported key: see supportedQueryValues and allowedCustomQueryPrefix.
// If an unsupported key is passed in, it will be ignored and nothing will be done. // If an unsupported key is passed in, it will be ignored and nothing will be done.
func (o *GetObjectOptions) SetReqParam(key, value string) { func (o *GetObjectOptions) SetReqParam(key, value string) {
if !isStandardQueryValue(key) { if !isCustomQueryValue(key) && !isStandardQueryValue(key) {
// do nothing // do nothing
return return
} }
@ -101,10 +101,10 @@ func (o *GetObjectOptions) SetReqParam(key, value string) {
} }
// AddReqParam - add request query string parameter // AddReqParam - add request query string parameter
// supported key: see supportedQueryValues. // supported key: see supportedQueryValues and allowedCustomQueryPrefix.
// If an unsupported key is passed in, it will be ignored and nothing will be done. // If an unsupported key is passed in, it will be ignored and nothing will be done.
func (o *GetObjectOptions) AddReqParam(key, value string) { func (o *GetObjectOptions) AddReqParam(key, value string) {
if !isStandardQueryValue(key) { if !isCustomQueryValue(key) && !isStandardQueryValue(key) {
// do nothing // do nothing
return return
} }

View file

@ -32,6 +32,12 @@
// to update tag(s) of a specific object version // to update tag(s) of a specific object version
type PutObjectTaggingOptions struct { type PutObjectTaggingOptions struct {
VersionID string VersionID string
Internal AdvancedObjectTaggingOptions
}
// AdvancedObjectTaggingOptions for internal use by MinIO server - not intended for client use.
type AdvancedObjectTaggingOptions struct {
ReplicationProxyRequest string
} }
// PutObjectTagging replaces or creates object tag(s) and can target // PutObjectTagging replaces or creates object tag(s) and can target
@ -50,7 +56,10 @@ func (c *Client) PutObjectTagging(ctx context.Context, bucketName, objectName st
if opts.VersionID != "" { if opts.VersionID != "" {
urlValues.Set("versionId", opts.VersionID) urlValues.Set("versionId", opts.VersionID)
} }
headers := make(http.Header, 0)
if opts.Internal.ReplicationProxyRequest != "" {
headers.Set(minIOBucketReplicationProxyRequest, opts.Internal.ReplicationProxyRequest)
}
reqBytes, err := xml.Marshal(otags) reqBytes, err := xml.Marshal(otags)
if err != nil { if err != nil {
return err return err
@ -63,6 +72,7 @@ func (c *Client) PutObjectTagging(ctx context.Context, bucketName, objectName st
contentBody: bytes.NewReader(reqBytes), contentBody: bytes.NewReader(reqBytes),
contentLength: int64(len(reqBytes)), contentLength: int64(len(reqBytes)),
contentMD5Base64: sumMD5Base64(reqBytes), contentMD5Base64: sumMD5Base64(reqBytes),
customHeader: headers,
} }
// Execute PUT to set a object tagging. // Execute PUT to set a object tagging.
@ -83,6 +93,7 @@ func (c *Client) PutObjectTagging(ctx context.Context, bucketName, objectName st
// to fetch the tagging key/value pairs // to fetch the tagging key/value pairs
type GetObjectTaggingOptions struct { type GetObjectTaggingOptions struct {
VersionID string VersionID string
Internal AdvancedObjectTaggingOptions
} }
// GetObjectTagging fetches object tag(s) with options to target // GetObjectTagging fetches object tag(s) with options to target
@ -96,12 +107,16 @@ func (c *Client) GetObjectTagging(ctx context.Context, bucketName, objectName st
if opts.VersionID != "" { if opts.VersionID != "" {
urlValues.Set("versionId", opts.VersionID) urlValues.Set("versionId", opts.VersionID)
} }
headers := make(http.Header, 0)
if opts.Internal.ReplicationProxyRequest != "" {
headers.Set(minIOBucketReplicationProxyRequest, opts.Internal.ReplicationProxyRequest)
}
// Execute GET on object to get object tag(s) // Execute GET on object to get object tag(s)
resp, err := c.executeMethod(ctx, http.MethodGet, requestMetadata{ resp, err := c.executeMethod(ctx, http.MethodGet, requestMetadata{
bucketName: bucketName, bucketName: bucketName,
objectName: objectName, objectName: objectName,
queryValues: urlValues, queryValues: urlValues,
customHeader: headers,
}) })
defer closeResponse(resp) defer closeResponse(resp)
@ -121,6 +136,7 @@ func (c *Client) GetObjectTagging(ctx context.Context, bucketName, objectName st
// RemoveObjectTaggingOptions holds the version id of the object to remove // RemoveObjectTaggingOptions holds the version id of the object to remove
type RemoveObjectTaggingOptions struct { type RemoveObjectTaggingOptions struct {
VersionID string VersionID string
Internal AdvancedObjectTaggingOptions
} }
// RemoveObjectTagging removes object tag(s) with options to control a specific object // RemoveObjectTagging removes object tag(s) with options to control a specific object
@ -134,12 +150,16 @@ func (c *Client) RemoveObjectTagging(ctx context.Context, bucketName, objectName
if opts.VersionID != "" { if opts.VersionID != "" {
urlValues.Set("versionId", opts.VersionID) urlValues.Set("versionId", opts.VersionID)
} }
headers := make(http.Header, 0)
if opts.Internal.ReplicationProxyRequest != "" {
headers.Set(minIOBucketReplicationProxyRequest, opts.Internal.ReplicationProxyRequest)
}
// Execute DELETE on object to remove object tag(s) // Execute DELETE on object to remove object tag(s)
resp, err := c.executeMethod(ctx, http.MethodDelete, requestMetadata{ resp, err := c.executeMethod(ctx, http.MethodDelete, requestMetadata{
bucketName: bucketName, bucketName: bucketName,
objectName: objectName, objectName: objectName,
queryValues: urlValues, queryValues: urlValues,
customHeader: headers,
}) })
defer closeResponse(resp) defer closeResponse(resp)

View file

@ -127,7 +127,7 @@ type Options struct {
// Global constants. // Global constants.
const ( const (
libraryName = "minio-go" libraryName = "minio-go"
libraryVersion = "v7.0.65" libraryVersion = "v7.0.66"
) )
// User Agent should always following the below style. // User Agent should always following the below style.

View file

@ -54,19 +54,36 @@ type IAM struct {
// Custom endpoint to fetch IAM role credentials. // Custom endpoint to fetch IAM role credentials.
Endpoint string Endpoint string
// Region configurable custom region for STS
Region string
// Support for container authorization token https://docs.aws.amazon.com/sdkref/latest/guide/feature-container-credentials.html
Container struct {
AuthorizationToken string
CredentialsFullURI string
CredentialsRelativeURI string
}
// EKS based k8s RBAC authorization - https://docs.aws.amazon.com/eks/latest/userguide/pod-configuration.html
EKSIdentity struct {
TokenFile string
RoleARN string
RoleSessionName string
}
} }
// IAM Roles for Amazon EC2 // IAM Roles for Amazon EC2
// http://docs.aws.amazon.com/AWSEC2/latest/UserGuide/iam-roles-for-amazon-ec2.html // http://docs.aws.amazon.com/AWSEC2/latest/UserGuide/iam-roles-for-amazon-ec2.html
const ( const (
defaultIAMRoleEndpoint = "http://169.254.169.254" DefaultIAMRoleEndpoint = "http://169.254.169.254"
defaultECSRoleEndpoint = "http://169.254.170.2" DefaultECSRoleEndpoint = "http://169.254.170.2"
defaultSTSRoleEndpoint = "https://sts.amazonaws.com" DefaultSTSRoleEndpoint = "https://sts.amazonaws.com"
defaultIAMSecurityCredsPath = "/latest/meta-data/iam/security-credentials/" DefaultIAMSecurityCredsPath = "/latest/meta-data/iam/security-credentials/"
tokenRequestTTLHeader = "X-aws-ec2-metadata-token-ttl-seconds" TokenRequestTTLHeader = "X-aws-ec2-metadata-token-ttl-seconds"
tokenPath = "/latest/api/token" TokenPath = "/latest/api/token"
tokenTTL = "21600" TokenTTL = "21600"
tokenRequestHeader = "X-aws-ec2-metadata-token" TokenRequestHeader = "X-aws-ec2-metadata-token"
) )
// NewIAM returns a pointer to a new Credentials object wrapping the IAM. // NewIAM returns a pointer to a new Credentials object wrapping the IAM.
@ -84,21 +101,55 @@ func NewIAM(endpoint string) *Credentials {
// the desired // the desired
func (m *IAM) Retrieve() (Value, error) { func (m *IAM) Retrieve() (Value, error) {
token := os.Getenv("AWS_CONTAINER_AUTHORIZATION_TOKEN") token := os.Getenv("AWS_CONTAINER_AUTHORIZATION_TOKEN")
if token == "" {
token = m.Container.AuthorizationToken
}
relativeURI := os.Getenv("AWS_CONTAINER_CREDENTIALS_RELATIVE_URI")
if relativeURI == "" {
relativeURI = m.Container.CredentialsRelativeURI
}
fullURI := os.Getenv("AWS_CONTAINER_CREDENTIALS_FULL_URI")
if fullURI == "" {
fullURI = m.Container.CredentialsFullURI
}
identityFile := os.Getenv("AWS_WEB_IDENTITY_TOKEN_FILE")
if identityFile == "" {
identityFile = m.EKSIdentity.TokenFile
}
roleArn := os.Getenv("AWS_ROLE_ARN")
if roleArn == "" {
roleArn = m.EKSIdentity.RoleARN
}
roleSessionName := os.Getenv("AWS_ROLE_SESSION_NAME")
if roleSessionName == "" {
roleSessionName = m.EKSIdentity.RoleSessionName
}
region := os.Getenv("AWS_REGION")
if region == "" {
region = m.Region
}
var roleCreds ec2RoleCredRespBody var roleCreds ec2RoleCredRespBody
var err error var err error
endpoint := m.Endpoint endpoint := m.Endpoint
switch { switch {
case len(os.Getenv("AWS_WEB_IDENTITY_TOKEN_FILE")) > 0: case identityFile != "":
if len(endpoint) == 0 { if len(endpoint) == 0 {
if len(os.Getenv("AWS_REGION")) > 0 { if region != "" {
if strings.HasPrefix(os.Getenv("AWS_REGION"), "cn-") { if strings.HasPrefix(region, "cn-") {
endpoint = "https://sts." + os.Getenv("AWS_REGION") + ".amazonaws.com.cn" endpoint = "https://sts." + region + ".amazonaws.com.cn"
} else { } else {
endpoint = "https://sts." + os.Getenv("AWS_REGION") + ".amazonaws.com" endpoint = "https://sts." + region + ".amazonaws.com"
} }
} else { } else {
endpoint = defaultSTSRoleEndpoint endpoint = DefaultSTSRoleEndpoint
} }
} }
@ -106,15 +157,15 @@ func (m *IAM) Retrieve() (Value, error) {
Client: m.Client, Client: m.Client,
STSEndpoint: endpoint, STSEndpoint: endpoint,
GetWebIDTokenExpiry: func() (*WebIdentityToken, error) { GetWebIDTokenExpiry: func() (*WebIdentityToken, error) {
token, err := os.ReadFile(os.Getenv("AWS_WEB_IDENTITY_TOKEN_FILE")) token, err := os.ReadFile(identityFile)
if err != nil { if err != nil {
return nil, err return nil, err
} }
return &WebIdentityToken{Token: string(token)}, nil return &WebIdentityToken{Token: string(token)}, nil
}, },
RoleARN: os.Getenv("AWS_ROLE_ARN"), RoleARN: roleArn,
roleSessionName: os.Getenv("AWS_ROLE_SESSION_NAME"), roleSessionName: roleSessionName,
} }
stsWebIdentityCreds, err := creds.Retrieve() stsWebIdentityCreds, err := creds.Retrieve()
@ -123,17 +174,16 @@ func (m *IAM) Retrieve() (Value, error) {
} }
return stsWebIdentityCreds, err return stsWebIdentityCreds, err
case len(os.Getenv("AWS_CONTAINER_CREDENTIALS_RELATIVE_URI")) > 0: case relativeURI != "":
if len(endpoint) == 0 { if len(endpoint) == 0 {
endpoint = fmt.Sprintf("%s%s", defaultECSRoleEndpoint, endpoint = fmt.Sprintf("%s%s", DefaultECSRoleEndpoint, relativeURI)
os.Getenv("AWS_CONTAINER_CREDENTIALS_RELATIVE_URI"))
} }
roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token) roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token)
case len(os.Getenv("AWS_CONTAINER_CREDENTIALS_FULL_URI")) > 0: case fullURI != "":
if len(endpoint) == 0 { if len(endpoint) == 0 {
endpoint = os.Getenv("AWS_CONTAINER_CREDENTIALS_FULL_URI") endpoint = fullURI
var ok bool var ok bool
if ok, err = isLoopback(endpoint); !ok { if ok, err = isLoopback(endpoint); !ok {
if err == nil { if err == nil {
@ -189,7 +239,7 @@ func getIAMRoleURL(endpoint string) (*url.URL, error) {
if err != nil { if err != nil {
return nil, err return nil, err
} }
u.Path = defaultIAMSecurityCredsPath u.Path = DefaultIAMSecurityCredsPath
return u, nil return u, nil
} }
@ -203,7 +253,7 @@ func listRoleNames(client *http.Client, u *url.URL, token string) ([]string, err
return nil, err return nil, err
} }
if token != "" { if token != "" {
req.Header.Add(tokenRequestHeader, token) req.Header.Add(TokenRequestHeader, token)
} }
resp, err := client.Do(req) resp, err := client.Do(req)
if err != nil { if err != nil {
@ -258,11 +308,11 @@ func fetchIMDSToken(client *http.Client, endpoint string) (string, error) {
ctx, cancel := context.WithTimeout(context.Background(), time.Second) ctx, cancel := context.WithTimeout(context.Background(), time.Second)
defer cancel() defer cancel()
req, err := http.NewRequestWithContext(ctx, http.MethodPut, endpoint+tokenPath, nil) req, err := http.NewRequestWithContext(ctx, http.MethodPut, endpoint+TokenPath, nil)
if err != nil { if err != nil {
return "", err return "", err
} }
req.Header.Add(tokenRequestTTLHeader, tokenTTL) req.Header.Add(TokenRequestTTLHeader, TokenTTL)
resp, err := client.Do(req) resp, err := client.Do(req)
if err != nil { if err != nil {
return "", err return "", err
@ -285,7 +335,7 @@ func fetchIMDSToken(client *http.Client, endpoint string) (string, error) {
// reading the response an error will be returned. // reading the response an error will be returned.
func getCredentials(client *http.Client, endpoint string) (ec2RoleCredRespBody, error) { func getCredentials(client *http.Client, endpoint string) (ec2RoleCredRespBody, error) {
if endpoint == "" { if endpoint == "" {
endpoint = defaultIAMRoleEndpoint endpoint = DefaultIAMRoleEndpoint
} }
// https://docs.aws.amazon.com/AWSEC2/latest/UserGuide/configuring-instance-metadata-service.html // https://docs.aws.amazon.com/AWSEC2/latest/UserGuide/configuring-instance-metadata-service.html
@ -332,7 +382,7 @@ func getCredentials(client *http.Client, endpoint string) (ec2RoleCredRespBody,
return ec2RoleCredRespBody{}, err return ec2RoleCredRespBody{}, err
} }
if token != "" { if token != "" {
req.Header.Add(tokenRequestHeader, token) req.Header.Add(TokenRequestHeader, token)
} }
resp, err := client.Do(req) resp, err := client.Do(req)

View file

@ -528,6 +528,14 @@ func isStandardQueryValue(qsKey string) bool {
return supportedQueryValues[qsKey] return supportedQueryValues[qsKey]
} }
// Per documentation at https://docs.aws.amazon.com/AmazonS3/latest/userguide/LogFormat.html#LogFormatCustom, the
// set of query params starting with "x-" are ignored by S3.
const allowedCustomQueryPrefix = "x-"
func isCustomQueryValue(qsKey string) bool {
return strings.HasPrefix(qsKey, allowedCustomQueryPrefix)
}
var ( var (
md5Pool = sync.Pool{New: func() interface{} { return md5.New() }} md5Pool = sync.Pool{New: func() interface{} { return md5.New() }}
sha256Pool = sync.Pool{New: func() interface{} { return sha256.New() }} sha256Pool = sync.Pool{New: func() interface{} { return sha256.New() }}

8
vendor/modules.txt vendored
View file

@ -350,14 +350,14 @@ github.com/json-iterator/go
# github.com/kballard/go-shellquote v0.0.0-20180428030007-95032a82bc51 # github.com/kballard/go-shellquote v0.0.0-20180428030007-95032a82bc51
## explicit ## explicit
github.com/kballard/go-shellquote github.com/kballard/go-shellquote
# github.com/klauspost/compress v1.17.2 # github.com/klauspost/compress v1.17.4
## explicit; go 1.18 ## explicit; go 1.19
github.com/klauspost/compress/flate github.com/klauspost/compress/flate
github.com/klauspost/compress/gzip github.com/klauspost/compress/gzip
github.com/klauspost/compress/s2 github.com/klauspost/compress/s2
github.com/klauspost/compress/snappy github.com/klauspost/compress/snappy
github.com/klauspost/compress/zlib github.com/klauspost/compress/zlib
# github.com/klauspost/cpuid/v2 v2.2.5 # github.com/klauspost/cpuid/v2 v2.2.6
## explicit; go 1.15 ## explicit; go 1.15
github.com/klauspost/cpuid/v2 github.com/klauspost/cpuid/v2
# github.com/leodido/go-urn v1.2.4 # github.com/leodido/go-urn v1.2.4
@ -382,7 +382,7 @@ github.com/miekg/dns
# github.com/minio/md5-simd v1.1.2 # github.com/minio/md5-simd v1.1.2
## explicit; go 1.14 ## explicit; go 1.14
github.com/minio/md5-simd github.com/minio/md5-simd
# github.com/minio/minio-go/v7 v7.0.65 # github.com/minio/minio-go/v7 v7.0.66
## explicit; go 1.17 ## explicit; go 1.17
github.com/minio/minio-go/v7 github.com/minio/minio-go/v7
github.com/minio/minio-go/v7/pkg/credentials github.com/minio/minio-go/v7/pkg/credentials